Themeisle vs Figcomponents

Comparing the features of Themeisle to Figcomponents

Feature
Themeisle
Figcomponents

Capability Features

Active Installations
2000000
Beginner Friendly
Component Copy-Paste
Component Library
Content Curation Automation
Create and Share Libraries
Customizable Themes
Download as ZIP
Embed Tables and Graphs
Exceptional Support
Flexible Starter Sites
Gutenberg Block Extension
Immediate Copy Action
No Account Required
Open Source
Responsive Themes
Support Team
Supported Component Types
buttonsdata visualizationsuser-interfaceelementwebsitesignupsectiondashboardapplicationprolanding-pagefeatureherotablewireframesketchdrawingprinticonlistmenusidebarinputiosiphoneapplemobile-appcalendarlightmarketingblogpostsdarkpricingloginemailroundstatusfaqfrequently-asked-questionsauthenticationsigninecommerceproductfiltercontactformdatakanbanto-doto-do-listchatwebshopstorefooteruploadvideotext-leftteammapworldlocationtestimonialquote
Tutorial Resources
How to install WordPress guideBest WordPress hosting comparedBest 9 free blogging sites comparedHow to create a successful blogStart an online store with WordPressHow to create a website for freeMost profitable blog nichesBest domain registrars to buy domains from
Web-based Access
WordPress Plugins
Otter BlocksVisualizerFeedzy
WordPress Theme
NeveHestia

Integration Features

Elementor Integration
Figma Integration
Figma Plugin Integration
WordPress Compatibility

Limitation Features

No API Mentioned
No Design Customization Tool
No Explicit Pricing Listed
No Mention of API
No Mention of Export Formats
No Paid Plans
No Project/Download Limits Stated
No Quotas or Limits Listed
Only for Figma
Terms of Use Required

Other Features

CC BY 4.0 License
CC BY 4.0

Pricing Features

Free Theme Available
Free Tier
Paid Theme Version