Figcomponents vs Free SaaS Website UI Kit

Comparing the features of Figcomponents to Free SaaS Website UI Kit

Feature
Figcomponents
Free SaaS Website UI Kit

Capability Features

3D Assets
Advanced Analytics
Advanced Filters
Advanced Security Features
Basic Support
Collaborative Workspaces
Component Copy-Paste
Component Library
Copy and Paste Elements
Create and Share Libraries
Custom Fields
Customizable 3D Shapes
Customizable Notifications
Dedicated Account Manager
Dedicated Support Channel
Slack channel and dedicated account manager
Device Breakpoints Supported
DesktopTabletMobile
Drag and Drop Builder
Export Capabilities
FAQ and Documentation
Free Domain Publishing
Goal Setting and Tracking
Immediate Copy Action
Industry Standard Security
Integration Ecosystem
Intuitive Time Tracking
No Account Required
No-code Functionality
Number of Sections and Components
100
Plan Change Flexibility
Priority Support
Progress Dashboard
Remixable Starter Project
Responsive Design
Section Types Included
3D AssetsBannerNavigationButtonHeroFeaturesPricingLogoTestimonialsFAQCTATooltipFooterTypographyPage Example LightPage Example Dark
Secure Data Encryption
Supported Component Types
buttonsdata visualizationsuser-interfaceelementwebsitesignupsectiondashboardapplicationprolanding-pagefeatureherotablewireframesketchdrawingprinticonlistmenusidebarinputiosiphoneapplemobile-appcalendarlightmarketingblogpostsdarkpricingloginemailroundstatusfaqfrequently-asked-questionsauthenticationsigninecommerceproductfiltercontactformdatakanbanto-doto-do-listchatwebshopstorefooteruploadvideotext-leftteammapworldlocationtestimonialquote
Unlimited Tasks and Projects
Web-based Access

Integration Features

API Access
Figma Integration
Figma Plugin Integration
Framer Integration
Official Framer Resource

Limitation Features

Figma Demo Pages Limit
2
No Design Customization Tool
No Mention of API
No Mention of Export Formats
No Paid Plans
No Project/Download Limits Stated
No-code Only
Only for Figma

Other Features

CC BY 4.0 License
CC BY 4.0
Framer Academy Support

Pricing Features

Business Plan Price
$19/month
Business Plan Project Members
Unlimited
Business Plan Storage
200GB
Free Plan Price
$0/month
Free Plan Project Members
5
Free Plan Storage
2GB
Free Tier
Payment Methods Accepted
All major credit cardsPayPalVarious other methods
Per-user Pricing
Pricing Plans
FreeProBusiness
Pro Plan Price
$9/month
Pro Plan Project Members
50
Pro Plan Storage
50GB