Bootstrap Icons vs licons

Comparing the features of Bootstrap Icons to licons

Feature
Bootstrap Icons
licons

Capability Features

Accessibility Features
aria-hiddenaria-labelrole=img
Adjust Stroke Width
1px1.5px2px
Copy Icon Mode
External Image Use
Feather-light Icons
Flexible Usage
Font-size and Color Styling
Icon Collections
accessibilityadjustments-altadjustmentsairplaneairplayalignment-centeralignment-justifyalignment-leftalignment-rightanchorarchivearrow-downarrow-leftarrow-rightarrow-upat-symbolattachmentbackwardbadge-checkbadgebag-alt-2bag-altbagbanbar-chart-altbar-chartbattery-0battery-1battery-2battery-3bell-altbellbluetoothbook-openbookbookmarkboxbriefcasebrowserbrushbugbulbcalculatorcalendar-altcalendarcameracastchartchat-altchatcheck-circlecheckchevron-down-circlechevron-downchevron-left-circlechevron-leftchevron-right-circlechevron-rightchevron-up-circlechevron-upcircleclipboardclock-altclockcloudcodecolorpickercommandcompasscopycredit-cardcross-circlecrosscurly-bracescursordata-altdatadiamonddots-horizontaldots-verticaldownloadeditexpand-altexpandeye-alteyefacefilmfilter-altfilterflagfolder-minusfolder-openfolder-plusfolderforwardfullscreengamepad-altgamepadglobegrid-minusgrid-plusgridhashtagheadphoneshearthelphexagon-checkhexagon-reporthome-althomeimageinboxinfolamplaptoplayerslayoutlightninglink-altlinklist-squarelistlocationlock-openlockmail-openmailmapmedalmemorymicrophoneminus-circleminus-squareminusmoonmosquemovemusicnewspaperoverlaypackagepaper-textpaperpausepenpencilperson-minusperson-pluspersonphone-arrowphone-crossphone-signalphonepin-altpinplayplus-circleplus-squarepluspoll-altpollprinterprocessorpulsepuzzleradioreceiptrefreshsavescissorsscreen-downloadscreen-uploadscreensearchsend-altsendsettings-alt-1settings-alt-2settingsshareshield-checkshield-reportshieldshopping-cartshrink-altshrinksmartphonesofa-altsofasound-wavesquarestarstickerstoragesunsupportswap-altswaptabletagtargettemplatetextthumbs-downthumbs-uptickettransformtrash-alttrashtwittertypefaceuploadvideovolume-highvolume-lowvolume-mutewalletwifiwindow-altwindowwrenchzoom-inzoom-out
Icon Font Support
Icon Usage in CSS Only
Modern Design
Multiple Icon Usage Methods
Embedded SVGSVG SpriteExternal ImageIcon FontCSS Background Image
No User Authentication
Open Source
Save Icon Mode
Supports Custom CSS Styling
Supports HTML Embed
Supports Icon Resizing
SVG Sprite Provided

Integration Features

Available as ZIP Release
CDN Support
CSS Integration
Install via Composer
Install via npm
Manual Download
Sass Integration
Supports Bootstrap Projects
Supports Icon Font via CDN
Supports Icon Font via Sass Import
Supports Multiple Package Managers
npmComposer
SVG File Format
Works with Bootstrap

Limitation Features

Browser Compatibility
Issues with Internet Explorer, Edge Legacy, and Chrome (external sprites)
Known SVG Browser Quirks
SVG focus in IE/EdgeSVG <img> accessibilitySVG sprite cross-domain ChromeExternal SVG sprite in IE
No API
No API Access
No File Formats Specified
No Platform Integrations Listed
No Premium Icons
No Sign-up Required
No Web UI for Customization

Other Features

License Provided

Pricing Features

Free Tier
No Quotas or Limits
Pricing Plans
Free/Open Source